Description

  • Product name

    Recombinant Human KLHDC1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MADSQLFCVAEERSGHCAVVDGNFLYVWGGYVSIEDNEVYLPNDEIWTYD IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN LRTRDETYIWEKITDFEGQPPTPRDKLSCWVYKDRLIYFGGYGCRRHSEL QDCFDVHDASWEEQIFWGWHNDVHIFDTKTQTWFQPEIKGGVPPQPRAAH TCAVLGNKGYIFGGRVLQTRMNDLHYLNLDTWTWSGRITINGESPKHRSW HTLTPIADDKLFLCGGLSADNIPLSDGWIHNVTTNCWKQLTHLPKTRPRL WHTACLGKENEIMVFGGSKDDLLALDTGHCNDLLIFQTQPYSLLRSCLDC IGKNSIMLESQISLLPPKLLQQVLKKITFWAAANHREEQRVQKEETENKY QWISSN
    • Amino acids

      1 to 406
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165192 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Kelch domain containing 1
    • Kelch domain containing protein 1
    • Kelch domain-containing protein 1
    • KLDC1_HUMAN
    • KLHDC 1
    • KLHDC1
    • MGC126644
    • MGC126646
    • MGC141300
    • MGC141301
    • MST025
    • OTTMUSP00000027959
    see all
  • Tissue specificity

    Widely expressed, with high levels in skeletal muscle, pancreas and liver. Undetectable in peripheral blood leukocytes.
  • Sequence similarities

    Contains 6 Kelch repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab165192 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165192 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165192.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up