Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGSGRKDFDVKHILRLRWKLFSHPSPSTGGPAGGGCLQQDGSGSFEHWG PSQSRLLKSQERSGVSTFWKKPSSSSSSSSSPSSSSSSFNPLNGTLLPVA TRLQQGAPGQGTQQPARTLFYVESLEEEVVPGMDFPGPHEKGLVLQELKV EPDNSSQATGEGCGHRLSSTGHSMTPQSDLDSSSSEEFYQAVHHAEQTFR KMESYLKQQQLCDVILIVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQ EEIKMEGIDPNALWDLVQFAYTGCLELKEDTIENLLAAACLLQLPQVVEV CCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSYTMENIMEVIRNQEF LLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQSRCNDLSMLLAF IRLPLLPPQILADLENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPR TKPRKSTVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAGMMNGRRLQFG VAVIDDKLFVIGGRDGLKTLNTVECYNPKTKTWTVLPPMSTHRHGLGVTV LEGPIYAVGGHDGWSYLNTVERWDPQSQQWTFVASMSIARSTVGVAALNG KLYSVGGRDGSSCLSSMEYYDPHTNKWNMCAPMCKRRGGVGVATCDGFLY AVGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCLLGD RLYAVGGYDGQTYLNTMESYDPQTNEWTQMASLNIGRAGACVVVIKQP
    • Molecular weight

      109 kDa including tags
    • Amino acids

      1 to 748

Specifications

Our Abpromise guarantee covers the use of ab132429 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ30047
    • Kelch (Drosophila) like 1
    • Kelch like 1
    • Kelch like 1 (Drosophila)
    • Kelch like protein 1
    • kelch-like family member 1
    • Kelch-like protein 1
    • KIAA1490
    • KLHL1
    • KLHL1_HUMAN
    • Mayven related protein 2
    • MRP2
    • OTTHUMP00000018492
    • OTTHUMP00000040834
    see all
  • Function

    May play a role in organizing the actin cytoskeleton of the brain cells.
  • Tissue specificity

    Highly expressed in brain.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 6 Kelch repeats.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132429 stained with Coomassie Blue.

References

ab132429 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132429.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up