Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQDEERYMTLNVQSKKRSSAQTSQLTFKDYSVTLHWYKILLGISGTVNGI LTLTLISLILLVSQGVLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNK DLCASRSADQTVPRPHFRLLYRKT
    • Amino acids
      1 to 124
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activating coreceptor NKp80
    • C type lectin domain family 5 member C
    • CLEC5C
    • killer cell lectin like receptor F1
    • Killer cell lectin like receptor subfamily F member 1
    • KLRF 1
    • Lectin like receptor F1
    • MGC119907
    • MGC119908
    • MGC119909
    • ML
    • NKp80
    see all
  • Relevance
    KLRF1 is involved in the natural killer mediated cytolysis of PHA-induced lymphoblasts.
  • Cellular localization
    Membrane; Single-pass type II membrane protein

Images

  • ab162516 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162516 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up