Description

  • Product name

    Recombinant human KMT1A / SUV39H1 protein
    See all KMT1A / SUV39H1 proteins and peptides
  • Biological activity

    Specific Activity: 0.4 pmol/min/μg.

    Assay conditions: 80 µL containing 50 mM Tris pH 8.8, 5 mM MgCl2, 4 mM DTT, 10 µM substrate peptide, 20 µM S-adenosylmethionine, and 20-40 ng ab196397 for 1 hour at room temperature. Add antibody against methylated K9 residue of histone H3, incubate 1 hour. Then, add secondary HRP-labeled antibody and incubate 30 minutes. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Purity

    >= 5 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDY KKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRH HRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRSHLGRITVENEV DLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLH KFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTD DGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFDL DYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFA TRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECK CGTESCRKYLF
    • Predicted molecular weight

      74 kDa including tags
    • Amino acids

      2 to 412
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 0.55% Glutathione, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • H3 K9 HMTase1
    • H3-K9-HMTase 1
    • Histone H3-K9 methyltransferase 1
    • Histone H3-K9 methyltransferase1
    • Histone lysine N methyltransferase, H3 lysine 9 specific 1
    • Histone-lysine N-methyltransferase SUV39H1
    • KMT1 A
    • KMT1A
    • Lysine N methyltransferase 1A
    • Lysine N-methyltransferase 1A
    • MG44
    • mIS6
    • Position-effect variegation 3-9 homolog
    • Su(var)3 9 homolog 1
    • Su(var)3-9 homolog 1
    • Suppressor of variegation 3 9 homolog 1 (Drosophila)
    • Suppressor of variegation 3-9 homolog 1
    • SUV39 H1
    • SUV39H
    • SUV39H1
    • SUV91_HUMAN
    see all
  • Function

    Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. Also weakly methylates histone H1 (in vitro). H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats. SUV39H1 is targeted to histone H3 via its interaction with RB1 and is involved in many processes, such as repression of MYOD1-stimulated differentiation, regulation of the control switch for exiting the cell cycle and entering differentiation, repression by the PML-RARA fusion protein, BMP-induced repression, repression of switch recombination to IgA and regulation of telomere length. Component of the eNoSC (energy-dependent nucleolar silencing) complex, a complex that mediates silencing of rDNA in response to intracellular energy status and acts by recruiting histone-modifying enzymes. The eNoSC complex is able to sense the energy status of cell: upon glucose starvation, elevation of NAD(+)/NADP(+) ratio activates SIRT1, leading to histone H3 deacetylation followed by dimethylation of H3 at 'Lys-9' (H3K9me2) by SUV39H1 and the formation of silent chromatin in the rDNA locus. Recruited by the large PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1, contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation.
  • Sequence similarities

    Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. Suvar3-9 subfamily.
    Contains 1 chromo domain.
    Contains 1 post-SET domain.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
  • Developmental stage

    Accumulates during mitosis at centromeres during prometaphase, but dissociates from the centromere at the meta- to anaphase transition.
  • Domain

    Although the SET domain contains the active site of enzymatic activity, both pre-SET and post-SET domains are required for methyltransferase activity. The SET domain also participates to stable binding to heterochromatin.
    In the pre-SET domain, Cys residues bind 3 zinc ions that are arranged in a triangular cluster; some of these Cys residues contribute to the binding of two zinc ions within the cluster.
  • Post-translational
    modifications

    Phosphorylated on serine residues, and to a lesser degree, on threonine residues. The phosphorylated form is stabilized by SBF1 and is less active in its transcriptional repressor function.
    Acetylated at Lys-266, leading to inhibition of enzyme activity. SIRT1-mediated deacetylation relieves this inhibition.
  • Cellular localization

    Nucleus. Nucleus lamina. Nucleus, nucleoplasm. Chromosome, centromere. Associates with centromeric constitutive heterochromatin.
  • Information by UniProt

Images

  • Example of specific activity of ab196397.

  • 10% SDS-PAGE analysis of ab196397 (1 μg) with Coomassie staining.

References

ab196397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up