Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKM DCVQQRKKQLAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFY
    • Amino acids

      2 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153023 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AU022152
    • EC 2.1.1.43
    • ERG-associated protein with SET domain
    • ESET
    • H3 K9 HMTase 4
    • H3-K9-HMTase 4
    • H3-K9-HMTase4
    • Histone H3 K9 methyltransferase 4
    • Histone H3-K9 methyltransferase 4
    • Histone-lysine N-methyltransferase SETDB1
    • KG1T
    • KIAA0067
    • KMT1E
    • Lysine N-methyltransferase 1E
    • MGC90670
    • mKIAA0067
    • SET domain bifurcated 1
    • Set domain protein, bifurcated, 1
    • SETB1_HUMAN
    • Setdb1
    see all
  • Function

    Histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. H3 'Lys-9' trimethylation is coordinated with DNA methylation. Probably forms a complex with MBD1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Its activity is dependent on MBD1 and is heritably maintained through DNA replication by being recruited by CAF-1. SETDB1 is targeted to histone H3 by TRIM28/TIF1B, a factor recruited by KRAB zinc-finger proteins.
  • Tissue specificity

    Widely expressed. High expression in testis.
  • Sequence similarities

    Belongs to the histone-lysine methyltransferase family. Suvar3-9 subfamily.
    Contains 1 MBD (methyl-CpG-binding) domain.
    Contains 1 post-SET domain.
    Contains 1 pre-SET domain.
    Contains 1 SET domain.
    Contains 2 Tudor domains.
  • Domain

    The pre-SET, SET and post-SET domains are all required for methyltransferase activity. The 347-amino-acid insertion in the SET domain has no effect on the catalytic activity.
    Isoform 2 lacks all domains required for histone methyltransferase activity.
  • Cellular localization

    Nucleus. Chromosome. Associated with non-pericentromeric regions of chromatin. Excluded from nucleoli and islands of condensed chromatin.
  • Information by UniProt

Images

  • ab153023 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153023 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153023.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up