Description

  • Product name

    Recombinant Human KMT3C / SMYD2 protein
    See all KMT3C / SMYD2 proteins and peptides
  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGN HCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENW NPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQ SDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFP DVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDR NDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARN VIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAA GEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      1 to 433
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      NM_020197.

Specifications

Our Abpromise guarantee covers the use of ab196427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 10% Glycerol

    Contains 90 µg/ml DDDDK peptide.

General Info

  • Alternative names

    • Histone methyltransferase SMYD2
    • HSKM B
    • HSKM-B
    • HSKMB
    • KMT3C
    • Lysine N-methyltransferase 3C
    • MGC119305
    • N lysine methyltransferase SMYD2
    • N-lysine methyltransferase SMYD2
    • SET and MYND domain containing 2
    • SET and MYND domain containing protein 2
    • SET and MYND domain-containing protein 2
    • Smyd2
    • SMYD2_HUMAN
    • Zinc finger MYND domain containing 14
    • ZMYND14
    see all
  • Function

    Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.
  • Sequence similarities

    Contains 1 MYND-type zinc finger.
    Contains 1 SET domain.
  • Cellular localization

    Cytoplasm > cytosol. Nucleus.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 4 µg ab196427 with Coomassie staining.

References

ab196427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up