Recombinant human KMT5A / SETD8 / Pr-SET7 protein (ab196432)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 84% SDS-PAGE
- Active: Yes
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human KMT5A / SETD8 / Pr-SET7 protein
See all KMT5A / SETD8 / Pr-SET7 proteins and peptides -
Biological activity
50 µl reaction mix (50 mM Tris, pH 8.8, 1 mM EDTA, 1 mM DTT, 40 µM S-adenosylhomocysteine, and 0-6 µg ab196432) is added to the wells coated with the substrate. Incubate for 2 hr. Add antibody against methylated residue of histone H4, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminsecent substrates and read luminescence.
-
Purity
>= 84 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVE YHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLG RLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASI EAHPWLKH -
Predicted molecular weight
44 kDa including tags -
Amino acids
195 to 352 -
Tags
GST tag N-Terminus -
Additional sequence information
Genbank accession number: NM_020382
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab196432 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 20% Glycerol (glycerin, glycerine), 0.49% GlutathioneThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- H4 K20 HMTase
- H4 K20 specific histone methyltransferase
- H4-K20-HMTase SETD8
see all -
Function
Protein-lysine N-methyltransferase that monomethylates both histones and non-histone proteins. Specifically monomethylates 'Lys-20' of histone H4 (H4K20me1). H4K20me1 is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, probably by contributing to the maintenance of proper higher order structure of DNA during mitosis. Involved in chromosome condensation and proper cytokinesis. Nucleosomes are preferred as substrate compared to free histones. Mediates monomethylation of p53/TP53 at 'Lys-382', leading to repress p53/TP53-target genes. -
Sequence similarities
Belongs to the histone-lysine methyltransferase family. PR/SET subfamily.
Contains 1 SET domain. -
Developmental stage
Not detected during G1 phase. First detected during S through G2 phases, and peaks during mitosis (at protein level). -
Domain
Although the SET domain contains the active site of enzymatic activity, both sequences upstream and downstream of the SET domain are required for methyltransferase activity. -
Cellular localization
Nucleus. Chromosome. Specifically localizes to mitotic chromosomes. Associates with silent chromatin on euchromatic arms. Not associated with constitutive heterochromatin. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab196432 has not yet been referenced specifically in any publications.