Description

  • Product name

    Recombinant Human KPC2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHG SLEDPKSITHHKLIHAASERVLSDARTILEENIQDQDVLLLIKKRAPSPL PKMADVSAEEKKKQDQKAPDKEAILRATANLPSYNMDRAAVQTNMRDFQT ELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDEDEDERVDEAALRQL TEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTIDTPLPGQAPPEAE GATAAASEAAAGASATDEEARDELTEIFKKIRRKREFRADARAVISLMEM GFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAI LDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQ TLNRT
    • Amino acids

      1 to 405
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110033G07Rik
    • AA407978
    • E3 ubiquitin-protein ligase subunit KPC2
    • GBDR1
    • Glialblastoma cell differentiation-related protein 1
    • Glialblastoma differentiation-related protein 1
    • Kip1 ubiquitination-promoting complex protein 2
    • kpc 2
    • Kpc2
    • OTTHUMP00000022563
    • Putative glialblastoma cell differentiation-related protein
    • RP11-432J22.3
    • UBA domain containing 1
    • UBA domain-containing protein 1
    • UBAC 1
    • UBAC1
    • Ubadc1
    • Ubiquitin associated domain containing 1
    • Ubiquitin-associated domain-containing protein 1
    see all
  • Relevance

    KPC2 (Kip1 ubiquitylation-promoting complex 2) together with KPC1 forms the ubiquitin ligase KPC, which regulates degradation of the cyclin-dependent kinase inhibitor p27 at the G1 phase of the cell cycle. KPC2 contains a ubiquitin-like (UBL) domain, two ubiquitin-associated (UBA) domains, and a heat shock chaperonin-binding (STI1) domain.
  • Cellular localization

    Cytoplasmic

Images

  • ab160981 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up