Description

  • Product name

    Recombinant Human KPNA5 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.
    ab199581 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFDAMASPGKDNYRMKSYKNKAL NPQEMRRRREEEGIQLRKQKREEQLFKRRNVYLPRNDESMLESPIQDPDI SSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQKFRKLLSKEPNPPIDQV IQKPGVVQRFVKFLERNENCTLQFEAAWALTNIASGTFLHTKVVIETGAV PIFIKLLNSEHEDVQEQAVWALGNIAGDNAECRDFVLNCEILPPLLELLT NSNRLTTTRNAVWALSNLCRGKNPPPNFSKVSPCLNVLSRLLFSSDPDVL ADVCWALSYLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVG NIVTGDDIQTQVILNCSALPCLLHLLSSPKESIRKEACWTVSNITAGNRA QIQAVIDANIFPVLIEILQKAEFRTRKEAAWAITNATSGGTPEQIRYLVA LGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCAL IEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEEDDPSIVPQVDENQ QQFIFQQQEAPMDGFQL
    • Predicted molecular weight

      64 kDa including tags
    • Amino acids

      1 to 536
    • Additional sequence information

      Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.

Specifications

Our Abpromise guarantee covers the use of ab199581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose, DTT.

General Info

  • Alternative names

    • IMA5_HUMAN
    • Importin alpha 6
    • Importin subunit alpha 6
    • Importin subunit alpha-6
    • IPOA 6
    • IPOA6
    • Karyopherin alpha 5
    • Karyopherin alpha 5 importin alpha 6
    • Karyopherin subunit alpha 5
    • Karyopherin subunit alpha-5
    • KPNA 5
    • KPNA5
    • SRP 6
    • SRP6
    see all
  • Function

    Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Mediates nuclear import of STAT1 homodimers and STAT1/STAT2 heterodimers by recognizing non-classical NLSs of STAT1 and STAT2 through ARM repeats 8-9. Recognizes influenza A virus nucleoprotein through ARM repeat 7-9 In vitro, mediates the nuclear import of human cytomegalovirus UL84 by recognizing a non-classical NLS.
  • Tissue specificity

    Testis.
  • Sequence similarities

    Belongs to the importin alpha family.
    Contains 10 ARM repeats.
    Contains 1 IBB domain.
  • Domain

    Consists of an N-terminal hydrophilic region, a hydrophobic central region composed of 10 repeats, and a short hydrophilic C-terminus. The N-terminal hydrophilic region contains the importin beta binding domain (IBB domain), which is sufficient for binding importin beta and essential for nuclear protein import.
    The IBB domain is thought to act as an intrasteric autoregulatory sequence by interacting with the internal autoinhibitory NLS. Binding of KPNB1 probably overlaps the internal NLS and contributes to a high affinity for cytoplasmic NLS-containing cargo substrates. After dissociation of the importin/substrate complex in the nucleus the internal autohibitory NLS contributes to a low affinity for nuclear NLS-containing proteins.
    The major and minor NLS binding sites are mainly involved in recognition of simple or bipartite NLS motifs. Structurally located within in a helical surface groove they contain several conserved Trp and Asn residues of the corresponding third helices (H3) of ARM repeats which mainly contribute to binding.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab199581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up