Description

  • Product name

    Recombinant Human KR102 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPV SCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACC VPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVC CVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVP VCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSG QKSSC
    • Amino acids

      1 to 255
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • High sulfur keratin-associated protein 10.2
    • KAP10.2
    • KAP18-2
    • KAP18.2
    • Keratin-associated protein 10-2
    • Keratin-associated protein 10.2
    • Keratin-associated protein 18-2
    • Keratin-associated protein 18.2
    • KR102_HUMAN
    • KRTAP10-2
    • KRTAP10.2
    • KRTAP18-2
    • KRTAP18.2
    see all
  • Function

    In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
  • Tissue specificity

    Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues.
  • Sequence similarities

    Belongs to the KRTAP type 10 family.
  • Information by UniProt

Images

  • ab166396 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up