For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-kras-protein-ab156968.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Ras Family
Share by email

Recombinant Human KRAS protein (ab156968)

  • Datasheet
  • SDS
Reviews (2) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human KRAS protein (ab156968)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 90% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE, MS

    You may also be interested in

    Primary
    Agarose Anti-V5 tag antibody (ab1229)
    Primary
    Product image
    Anti-CENPB antibody (ab25734)
    Primary
    Product image
    Anti-Lysophospholipase 1/LPL-I antibody [EPR3667] (ab91606)

    View more associated products

    Description

    • Product name

      Recombinant Human KRAS protein
      See all KRAS proteins and peptides
    • Purity

      > 90 % SDS-PAGE.
      ab156968 purified using conventional chromatography techniques.
    • Expression system

      Escherichia coli
    • Accession

      P01116
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MGSSHHHHHHSSGLVPRGSHMGSHMTEYKLVVVGAGGVGKSALTIQLIQN HFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGE GFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVD TKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEK TPGCVKIKKC
      • Predicted molecular weight

        24 kDa including tags
      • Amino acids

        1 to 186
      • Tags

        His tag N-Terminus

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-Ras antibody [4F3] (ab55391)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab156968 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Mass Spectrometry

    • Mass spectrometry

      MALDI-TOF
    • Form

      Liquid
    • Additional notes

      Isoform 2A. The mass of this protein was confirmed by mass spectroscopy.

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      pH: 8.00
      Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chloride

    General Info

    • Alternative names

      • c Ki ras2
      • c Kirsten ras protein
      • c-K-ras
      • c-Ki-ras
      • Cellular c Ki ras2 proto oncogene
      • Cellular transforming proto oncogene
      • CFC2
      • cK Ras
      • GTPase KRas
      • K RAS p21 protein
      • K RAS2A
      • K RAS2B
      • K RAS4A
      • K RAS4B
      • K-Ras 2
      • KI RAS
      • Ki-Ras
      • KIRSTEN MURINE SARCOMA VIRUS 2
      • Kirsten rat sarcoma 2 viral (v Ki ras2) oncogene homolog
      • Kirsten rat sarcoma viral oncogene homolog
      • KRAS
      • KRAS proto oncogene, GTPase
      • KRAS1
      • KRAS2
      • N-terminally processed
      • NS
      • NS3
      • Oncogene KRAS2
      • p21ras
      • PR310 c K ras oncogene
      • PR310 cK ras oncogene
      • RALD
      • RASK_HUMAN
      • RASK2
      • Transforming protein p21
      • v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog
      • v Ki ras2 Kirsten rat sarcoma viral oncogene homolog
      see all
    • Function

      Ras proteins bind GDP/GTP and possess intrinsic GTPase activity.
    • Involvement in disease

      Defects in KRAS are a cause of acute myelogenous leukemia (AML) [MIM:601626]. AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development.
      Defects in KRAS are a cause of juvenile myelomonocytic leukemia (JMML) [MIM:607785]. JMML is a pediatric myelodysplastic syndrome that constitutes approximately 30% of childhood cases of myelodysplastic syndrome (MDS) and 2% of leukemia. It is characterized by leukocytosis with tissue infiltration and in vitro hypersensitivity of myeloid progenitors to granulocyte-macrophage colony stimulating factor.
      Defects in KRAS are the cause of Noonan syndrome type 3 (NS3) [MIM:609942]. Noonan syndrome (NS) [MIM:163950] is a disorder characterized by dysmorphic facial features, short stature, hypertelorism, cardiac anomalies, deafness, motor delay, and a bleeding diathesis. It is a genetically heterogeneous and relatively common syndrome, with an estimated incidence of 1 in 1000-2500 live births. Rarely, NS is associated with juvenile myelomonocytic leukemia (JMML). NS3 inheritance is autosomal dominant.
      Defects in KRAS are a cause of gastric cancer (GASC) [MIM:613659]; also called gastric cancer intestinal or stomach cancer. Gastric cancer is a malignant disease which starts in the stomach, can spread to the esophagus or the small intestine, and can extend through the stomach wall to nearby lymph nodes and organs. It also can metastasize to other parts of the body. The term gastric cancer or gastric carcinoma refers to adenocarcinoma of the stomach that accounts for most of all gastric malignant tumors. Two main histologic types are recognized, diffuse type and intestinal type carcinomas. Diffuse tumors are poorly differentiated infiltrating lesions, resulting in thickening of the stomach. In contrast, intestinal tumors are usually exophytic, often ulcerating, and associated with intestinal metaplasia of the stomach, most often observed in sporadic disease.
      Note=Defects in KRAS are a cause of pylocytic astrocytoma (PA). Pylocytic astrocytomas are neoplasms of the brain and spinal cord derived from glial cells which vary from histologically benign forms to highly anaplastic and malignant tumors.
      Defects in KRAS are a cause of cardiofaciocutaneous syndrome (CFC syndrome) [MIM:115150]; also known as cardio-facio-cutaneous syndrome. CFC syndrome is characterized by a distinctive facial appearance, heart defects and mental retardation. Heart defects include pulmonic stenosis, atrial septal defects and hypertrophic cardiomyopathy. Some affected individuals present with ectodermal abnormalities such as sparse, friable hair, hyperkeratotic skin lesions and a generalized ichthyosis-like condition. Typical facial features are similar to Noonan syndrome. They include high forehead with bitemporal constriction, hypoplastic supraorbital ridges, downslanting palpebral fissures, a depressed nasal bridge, and posteriorly angulated ears with prominent helices. The inheritance of CFC syndrome is autosomal dominant.
      Note=KRAS mutations are involved in cancer development.
    • Sequence similarities

      Belongs to the small GTPase superfamily. Ras family.
    • Cellular localization

      Cell membrane.
    • Target information above from: UniProt accession P01116 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human KRAS protein (ab156968)
      SDS-PAGE - Recombinant Human KRAS protein (ab156968)
      15% SDS-PAGE analysis of ab156968 (3 µg).

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab156968? Please let us know so that we can cite the reference in this datasheet.

    ab156968 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Western blot of KRAS protein

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Performed a Western blot of 10 ng KRAS protein (ab156968). Primary antibody (ab275876) was incubated for 16 hours at 4°C and HRP-conjugated secondary antibody was incubated for 1 hour at room temp. Chemiluminescent detection reagent was used.

    Abcam user community

    Verified customer

    Submitted Jan 26 2021

    Direct ELISA with KRAS protein

    Excellent
    Abreviews
    Abreviews
    abreview image
    Application
    ELISA
    9 nM KRAS protein (ab156968) was coated onto plate. ab108602 (anti-RAS) was titrated as primary detection antibody. HRP-conjugated secondary antibody was used, and TMB was used as detection reagent.

    Abcam user community

    Verified customer

    Submitted Jan 04 2021

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.