Recombinant Human KRIT1 protein (ab113196)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human KRIT1 protein -
Purity
> 90 % SDS-PAGE.
Purity is >90%, by SDS-PAGE and silver stain. -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MLLKEAINKPYEKVRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQ QYFTIWICSENLSLQLKPYHKPLQHVRDWPEILAELTNLDPQRETPQLFL RRDVRLPLEVEKQIEDPLAILILFDEARYNLLKGFYTAPDAKLITLASLL LQIVYGNYESKKHKQGFLNEENLKSIVPVTKLKSKAPHWTNRILHEYKNL STSEGVSKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPV YVGVNIKGLHLLNMETKALLISLKYGCFMWQLGDTDTCFQIHSMENKMSF IVHTKQAGLVVKLLMKLNGQLMPTERNSLE -
Predicted molecular weight
39 kDa including tags -
Amino acids
203 to 529 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab113196 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 0.18% Sodium chloride
-
Reconstitutionab113196 is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium containing at least 0.1% Human or BSA to a concentration not lower than 50 µg/ml.
General Info
-
Alternative names
- Ankyrin repeat containing protein Krit1
- CAM
- CCM 1
see all -
Function
Negative regulator of angiogenesis. Inhibits endothelial proliferation, apoptosis, migration, lumen formation and sprouting angiogenesis in primary endothelial cells. Promotes AKT phosphorylation in a NOTCH-dependent and independent manner, and inhibits EKR1/2 phosphorylation indirectly through activation of the DELTA-NOTCH cascade. Acts in concert with CDH5 to establish and maintain correct endothelial cell polarity and vascular lumen and these effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction. Plays an important role in the maintenance of the intracellular reactive oxygen species (ROS) homeostasis to prevent oxidative cellular damage. Regulates the homeostasis of intracellular ROS through an antioxidant pathway involving FOXO1 and SOD2. Facilitates the down-regulation of cyclin D1 levels required for cell transition from proliferative growth to quiescence by preventing the accumulation of intracellular ROS through the modulation of FOXO1 and SOD2 levels. -
Tissue specificity
Low levels in brain. Very weak expression found in heart and muscle. -
Involvement in disease
Defects in KRIT1 are the cause of cerebral cavernous malformations type 1 (CCM1) [MIM:116860]. Cerebral cavernous malformations (CCMs) are congenital vascular anomalies of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. CCMs have an incidence of 0.1%-0.5% in the general population and usually present clinically during the 3rd to 5th decade of life. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. -
Sequence similarities
Contains 4 ANK repeats.
Contains 1 FERM domain. -
Cellular localization
Membrane. Cell junction. KRIT1 and CDH5 reciprocally regulate their localization to endothelial cell-cell junctions. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab113196 has not yet been referenced specifically in any publications.