Overview

  • Product name
    Recombinant Human KRR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDN PRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMT VCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSL VRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLK EVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKN VNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKME AIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKV KKAKNKKLGALTAEEIALKMEADEKKKKKKK
    • Amino acids
      1 to 381
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HIV 1 Rev binding protein 2
    • HIV-1 Rev-binding protein 2
    • HRB2
    • KRR1
    • KRR1 small subunit processome component homolog
    • KRR1, small subunit (SSU) processome component, homolog (yeast)
    • KRR1_HUMAN
    • Rev interacting protein 1
    • Rev-interacting protein 1
    • RIP 1
    • Rip-1
    see all
  • Function
    Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.
  • Sequence similarities
    Belongs to the KRR1 family.
    Contains 1 KH domain.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab161298 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up