Overview

  • Product name
    Recombinant Human KRT24 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRD LVSGDSRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
    • Amino acids
      426 to 525
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK 24
    • Cytokeratin 24
    • FLJ20261
    • K24
    • KA24
    • Keratin 24
    • Keratin, type I cytoskeletal 24
    • KRT24
    • MGC138169
    • MGC138173
    • Type I keratin 24
    see all
  • Relevance
    KRT24 is a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, comprise the cytoskeleton of epithelial cells. KRT24 is highly expressed in keratinocytes, placenta, colon and spleen, and has been found to be up-regulated in the mucosa of patients suffering of colorectal cancer.
  • Cellular localization
    Intermediate filament; keratin

Images

  • ab165829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up