Overview

  • Product name
    Recombinant Human KRT6L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHC GPGTGGFGSRSLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGA GRQTFGPACPPGGIQEVTVNQSLLTPLHVEIDPEIQRVRTQEREQIKTLN NKFASFIDKVRFLEQQNKVLETKWALLQEQGQNLGVTRNNLEPLFEAYLG SMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINKHTAAENEFVV LKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGK HGDNLRDTKNEIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELA LKDAQKKLGDLDVALHQAKEDLTRLLRDYQELMNVKLALDVEIATYRKLL ESEESRMSGECPSAVSISVTGNSTTVCGGGAASFGGGISLGGSGGATKGG FSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY
    • Amino acids
      1 to 535
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK 79
    • Cytokeratin 79
    • Cytokeratin79
    • FLJ26646
    • K6L
    • K79
    • KB38
    • Keratin 6 like
    • Keratin 6L
    • Keratin 79
    • Keratin type II cytoskeletal 79
    • Keratin79
    • KRT 79
    • KRT6L
    • KRT79
    • Type II keratin 38
    • Type II keratin Kb38
    see all
  • Relevance
    Keratins, such as KRT6L, are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. KRT6L is expressed in skeletal muscle, skin and scalp, but not in any other tissues or organs examined.

Images

  • ab166256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up