Description

  • Product name

    Recombinant Human KRT79 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHC GPGTGGFGSRSLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGA GRQTFGPACPPGGIQEVTVNQSLLTPLHVEIDPEIQRVRTQEREQIKTLN NKFASFIDKVRFLEQQNKVLETKWALLQEQGQNLGVTRNNLEPLFEAYLG SMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINKHTAAENEFVV LKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGK HGDNLRDTKNEIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELA LKDAQKKLGDLDVALHQAKEDLTRLLRDYQELMNVKLALDVEIATYRKLL ESEESRMSGECPSAVSISVTGNSTTVCGGGAASFGGGISLGGSGGATKGG FSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY
    • Amino acids

      1 to 535
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KRT6L. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CK 79
    • Cytokeratin 79
    • Cytokeratin79
    • FLJ26646
    • K6L
    • K79
    • KB38
    • Keratin 6 like
    • Keratin 6L
    • Keratin 79
    • Keratin type II cytoskeletal 79
    • Keratin79
    • KRT 79
    • KRT6L
    • KRT79
    • Type II keratin 38
    • Type II keratin Kb38
    see all
  • Relevance

    Keratins, such as KRT79, are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. KRT6L is expressed in skeletal muscle, skin and scalp, but not in any other tissues or organs examined.

Images

  • ab166256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up