Recombinant Human KRTHA3B protein (ab158806)

Overview

  • Product name
    Recombinant Human KRTHA3B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEG SFNGSEKETMQFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLC PSYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLAADDFRTKYQTEQS LRQLVESDINSLRRILDELTLCRSDLEAQMESLKEELLSLKQNHEQEVNT LRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNRREVEQWFATQ TEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE CEINTYRSLLESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCN TFGY
    • Amino acids
      1 to 404
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HA 3II
    • HA3II
    • Hair keratin
    • Hair keratin type I Ha3 II
    • Hard keratin type I 3II
    • hHa3 II
    • hHa3II
    • HKA3B
    • K33B
    • Keratin
    • Keratin 33B
    • Keratin hair acidic 3B
    • Keratin hair acidic3B
    • Keratin type I cuticular Ha3 II
    • Keratin-33B
    • Keratin33B
    • KRT 33B
    • KRT33B
    • KRTHA 3B
    • KRTHA3A
    • KRTHA3B
    • KT33B_HUMAN
    • type I cuticular Ha3-II
    • type I Ha3-II
    • Type I hair keratin 3B
    see all
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab158806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up