Overview

  • Product name
    Recombinant Human KRTHB3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTCGFNSIGCGFRPGNFSCVSACGPRPSRCCITAAPYRGISCYRGLTGGF GSHSVCGGFRAGSCGRSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEI DPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQFYQNRE CCQSNLEPLFAGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYE EEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEE EIRILQSHISDTSVVVKLDNSRDLNMDCIVAEIKAQYDDIATRSRAEAES WYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSK LEAAVAQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNS KLGLDIEIATYRRLLEGEEQRLCEGVEAVNVCVSSSRGGVVCGDLCVSGS RPVTGSVCSAPCNGNLVVSTGLCKPCGQLNTTCGGGSCGQGRH
    • Amino acids
      1 to 493
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Hair keratin K2.10
    • Hard keratin, type II, 3
    • HB 3
    • HB3
    • hHb3
    • K2.10
    • K83
    • Keratin
    • Keratin 83
    • Keratin, hair, basic, 3
    • Keratin-83
    • Krt83
    • KRT83_HUMAN
    • KRTHB3
    • type II cuticular Hb3
    • Type II hair keratin Hb3
    • Type-II keratin Kb23
    see all
  • Tissue specificity
    Synthesis begins in the cortex 10-15 cell layers above the apex of the dermal papilla and ends abruptly in the middle of the cortex.
  • Involvement in disease
    Defects in KRT83 are a cause of monilethrix (MLTRX) [MIM:158000]. Monilethrix is an autosomal dominant hair disorder characterized clinically by alopecia and follicular papules. Affected hairs have uniform elliptical nodes of normal thickness and intermittent constrictions, internodes at which the hair easily breaks. Usually only the scalp is involved, but in severe forms, the secondary sexual hair, eyebrows, eyelashes, and nails may also be affected.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab158808 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up