Description

  • Product name

    Recombinant human KSR2 protein
    See all KSR2 proteins and peptides
  • Biological activity

    The specific activity of ab185259 was determined to be 150 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILE GNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLSARSFPRKASQTS IFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQ LKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRD AKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYDNGKVVITD FGLFSISGVLQAGRREDKLRIQNGWLCHLAPEIIRQLSPDTEEDKLPFSK HSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEI SDILLFCWAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAEL
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      554 to 950
    • Tags

      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab185259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab204856 (CREB peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ25965
    • hKSR 2
    • hKSR2
    • Kinase suppressor of Ras 2
    • KSR 2
    • Ksr2
    • KSR2_HUMAN
    see all
  • Function

    Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.
  • Tissue specificity

    Mainly expressed in brain and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications

    Phosphorylated on Ser-474 by MARK3.
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • The specific activity of KSR2 (ab185259) was determined to be 135 nmol/min/mg as per activity assay protocol
  • SDS PAGE analysis of ab185259
  • SDS PAGE analysis of ab185259
  • SDS-PAGE analysis of ab185259.

  • Kinase Assay showing the specific activity of ab185259 as 150 nmol/min/mg.

References

ab185259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up