For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-ksr2-protein-ab185259.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Kinases MAPK Pathway
Share by email

Recombinant human KSR2 protein (ab185259)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human KSR2 protein (ab185259)
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
  • Functional Studies - Recombinant human KSR2 protein (ab185259)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: > 70% Densitometry
  • Active: Yes
  • Tags: proprietary tag N-Terminus
  • Suitable for: WB, Functional Studies, SDS-PAGE

Description

  • Product name

    Recombinant human KSR2 protein
    See all KSR2 proteins and peptides
  • Biological activity

    The specific activity of ab185259 was determined to be 150 nmol/min/mg.

  • Purity

    > 70 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    Q6VAB6
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RQQKNFNLPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILE GNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLSARSFPRKASQTS IFLQEWDIPFEQLEIGELIGKGRFGQVYHGRWHGEVAIRLIDIERDNEDQ LKAFKREVMAYRQTRHENVVLFMGACMSPPHLAIITSLCKGRTLYSVVRD AKIVLDVNKTRQIAQEIVKGMGYLHAKGILHKDLKSKNVFYDNGKVVITD FGLFSISGVLQAGRREDKLRIQNGWLCHLAPEIIRQLSPDTEEDKLPFSK HSDVFALGTIWYELHAREWPFKTQPAEAIIWQMGTGMKPNLSQIGMGKEI SDILLFCWAFEQEERPTFTKLMDMLEKLPKRNRRLSHPGHFWKSAEL
    • Predicted molecular weight

      72 kDa including tags
    • Amino acids

      554 to 950
    • Tags

      proprietary tag N-Terminus

Associated products

  • Substrate reagent

    • CREB peptide (ab204856)

Specifications

Our Abpromise guarantee covers the use of ab185259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab204856 (CREB peptide) can be utilized as a substrate for assessing kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol (glycerin, glycerine)

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ25965
    • hKSR 2
    • hKSR2
    • Kinase suppressor of Ras 2
    • KSR 2
    • Ksr2
    • KSR2_HUMAN
    see all
  • Function

    Location-regulated scaffold connecting MEK to RAF. Blocks MAP3K8 kinase activity and MAP3K8-mediated signaling. Acts as a negative regulator of MAP3K3-mediated activation of ERK, JNK and NF-kappa-B pathways, inhibiting MAP3K3-mediated interleukin-8 production.
  • Tissue specificity

    Mainly expressed in brain and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 protein kinase domain.
  • Domain

    The protein kinase domain is predicted to be catalytically inactive.
  • Post-translational
    modifications

    Phosphorylated on Ser-474 by MARK3.
  • Cellular localization

    Cytoplasm. Membrane.
  • Target information above from: UniProt accession Q6VAB6 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human KSR2 protein (ab185259)
    Functional Studies - Recombinant human KSR2 protein (ab185259)
    The specific activity of KSR2 (ab185259) was determined to be 135 nmol/min/mg as per activity assay protocol
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
    SDS-PAGE - Recombinant human KSR2 protein (ab185259)
    SDS PAGE analysis of ab185259
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
    SDS-PAGE - Recombinant human KSR2 protein (ab185259)
    SDS PAGE analysis of ab185259
  • SDS-PAGE - Recombinant human KSR2 protein (ab185259)
    SDS-PAGE - Recombinant human KSR2 protein (ab185259)

    SDS-PAGE analysis of ab185259.

  • Functional Studies - Recombinant human KSR2 protein (ab185259)
    Functional Studies - Recombinant human KSR2 protein (ab185259)

    Kinase Assay showing the specific activity of ab185259 as 150 nmol/min/mg.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab185259? Please let us know so that we can cite the reference in this datasheet.

    ab185259 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab185259.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.