Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFE SQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFK NIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVC ANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFL DLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKE TRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEPVKTKT RTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGF KPLVLLKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRY TPRRNIPPYFVALVPQEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTE KIMATPEQVGKMKAIVEKLRFTYRSDSFENPVLQQHFRNLEALALDLMEP EQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGKVTKRKHDNEGS GSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQELL EALTKHFQD
    • Molecular weight
      93 kDa including tags
    • Amino acids
      1 to 609

Specifications

Our Abpromise guarantee covers the use of ab132938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5''-deoxyribose-5-phosphate lyase Ku70
    • 5''-dRP lyase Ku70
    • 70 kDa subunit of Ku antigen
    • ATP dependent DNA helicase 2 subunit 1
    • ATP dependent DNA helicase II 70 kDa subunit
    • ATP-dependent DNA helicase 2 subunit 1
    • ATP-dependent DNA helicase II 70 kDa subunit
    • CTC box binding factor 75 kDa subunit
    • CTC box-binding factor 75 kDa subunit
    • CTC75
    • CTCBF
    • DNA repair protein XRCC6
    • G22P1
    • Ku 70
    • Ku autoantigen p70 subunit
    • Ku autoantigen, 70kDa
    • Ku p70
    • Ku70
    • Ku70 DNA binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa
    • Kup70
    • Lupus Ku autoantigen protein p70
    • ML8
    • Thyroid autoantigen
    • Thyroid autoantigen 70kD (Ku antigen)
    • Thyroid lupus autoantigen
    • Thyroid lupus autoantigen p70
    • Thyroid-lupus autoantigen
    • TLAA
    • X ray repair complementing defective repair in Chinese hamster cells 6
    • X-ray repair complementing defective repair in Chinese hamster cells 6
    • X-ray repair cross-complementing protein 6
    • XRCC 6
    • Xrcc6
    • XRCC6_HUMAN
    see all
  • Function
    Single stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. Required for osteocalcin gene expression. Probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. 5'-dRP lyase activity allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription.
  • Sequence similarities
    Belongs to the ku70 family.
    Contains 1 Ku domain.
    Contains 1 SAP domain.
  • Developmental stage
    Expression does not increase during promyelocyte differentiation.
  • Post-translational
    modifications
    Phosphorylation by PRKDC may enhance helicase activity. Phosphorylation of Ser-51 does not affect DNA repair.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132938 stained with Coomassie Blue

References

ab132938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up