Description

  • Product name

    Recombinant Human Ku80 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAEN KDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQP GSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDII IHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQ QKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCR LTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDD DETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQ VQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKR ANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQ LNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALH PREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTA QEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRV LVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFS EEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEE AKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
    • Predicted molecular weight

      106 kDa including tags
    • Amino acids

      1 to 732

Specifications

Our Abpromise guarantee covers the use of ab132946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 86 kDa subunit of Ku antigen
    • ATP dependent DNA helicase 2 subunit 2
    • ATP dependent DNA helicase II
    • ATP dependent DNA helicase II 80 kDa subunit
    • ATP dependent DNA helicase II 86 Kd subunit
    • ATP-dependent DNA helicase 2 subunit 2
    • ATP-dependent DNA helicase II 80 kDa subunit
    • CTC box binding factor 85 kDa
    • CTC box-binding factor 85 kDa subunit
    • CTC85
    • CTCBF
    • DNA repair protein XRCC5
    • KARP 1
    • KARP1
    • Ku 80
    • Ku autoantigen 80kDa
    • Ku80
    • Ku86
    • Ku86 autoantigen related protein 1
    • KUB 2
    • KUB2
    • Lupus Ku autoantigen protein p86
    • NFIV
    • Nuclear factor IV
    • Thyroid lupus autoantigen
    • Thyroid-lupus autoantigen
    • TLAA
    • X ray repair complementing defective repair in Chinese hamster cells 5 (double strand break rejoining)
    • X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
    • X-ray repair cross-complementing protein 5
    • Xray repair complementing defective repair in Chinese hamster cells 5
    • XRCC 5
    • XRCC5
    • XRCC5_HUMAN
    see all
  • Function

    Single stranded DNA-dependent ATP-dependent helicase. Has a role in chromosome translocation. The DNA helicase II complex binds preferentially to fork-like ends of double-stranded DNA in a cell cycle-dependent manner. It works in the 3'-5' direction. Binding to DNA may be mediated by XRCC6. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. The XRCC5/6 dimer acts as regulatory subunit of the DNA-dependent protein kinase complex DNA-PK by increasing the affinity of the catalytic subunit PRKDC to DNA by 100-fold. The XRCC5/6 dimer is probably involved in stabilizing broken DNA ends and bringing them together. The assembly of the DNA-PK complex to DNA ends is required for the NHEJ ligation step. In association with NAA15, the XRCC5/6 dimer binds to the osteocalcin promoter and activates osteocalcin expression. The XRCC5/6 dimer probably also acts as a 5'-deoxyribose-5-phosphate lyase (5'-dRP lyase), by catalyzing the beta-elimination of the 5' deoxyribose-5-phosphate at an abasic site near double-strand breaks. XRCC5 probably acts as the catalytic subunit of 5'-dRP activity, and allows to 'clean' the termini of abasic sites, a class of nucleotide damage commonly associated with strand breaks, before such broken ends can be joined. The XRCC5/6 dimer together with APEX1 acts as a negative regulator of transcription.
  • Sequence similarities

    Belongs to the ku80 family.
    Contains 1 Ku domain.
  • Developmental stage

    Expression increases during promyelocyte differentiation.
  • Domain

    The EEXXXDDL motif is required for the interaction with catalytic subunit PRKDC and its recruitment to sites of DNA damage.
  • Post-translational
    modifications

    Phosphorylated on serine residues. Phosphorylation by PRKDC may enhance helicase activity.
    Sumoylated.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132946 stained with Coomassie Blue

References

ab132946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up