Description

  • Product name

    Recombinant Human L3MBTL2 protein
  • Purity

    >= 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLN SDAVLPSRVYWIASVIQTAGYRVLLRYEGFENDASHDFWCNLGTVDVHPI GWCAINSKILVPPRTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMK YPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHM WSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRA VYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTD GLDWFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSK AAPSRLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHF DGWDSEYDQWVDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATK KKKKQ
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      178 to 625
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_031488

Specifications

Our Abpromise guarantee covers the use of ab198467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab198467 is useful for the study of Polycomb group (PcG) proteins, protein binding studies,screening inhibitors, and selectivityprofiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • 3bt like 2 protein
    • 3bt like protein
    • DKFZP761I141
    • H-l(3)mbt-like protein
    • H-l(3)mbt-like protein 2
    • Hl
    • Hl(3)mbt like protein
    • Hl(3)mbtl
    • L
    • l(3)mbt like 2
    • l(3)mbt like 2 (Drosophila)
    • L(3)mbt-like 2 protein
    • L(3)mbt-like protein 2
    • L3MBTL2
    • Lethal
    • Lethal(3)malignant brain tumor-like 2 protein
    • Lethal(3)malignant brain tumor-like protein 2
    • LMBL2_HUMAN
    see all
  • Function

    Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Its association with a chromatin-remodeling complex suggests that it may contribute to prevent expression of genes that trigger the cell into mitosis. Binds to monomethylated and dimethylated 'Lys-20' on histone H4. Binds histone H3 peptides that are monomethylated or dimethylated on 'Lys-4', 'Lys-9' or 'Lys-27'.
  • Sequence similarities

    Contains 1 FCS-type zinc finger.
    Contains 4 MBT repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS PAGE of 2 μg ab198476 stainined with Coomassie

References

ab198467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198467.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up