Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELA LVDVLEDKLK GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAG VRQQEGESRLNLVQRNVNVFKF IIPQIVKYSPDCIIIVVSNPVDILTY VTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG IHPSSCHGWILGEH GDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY EV IKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSL PCILNARG LTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
    • Molecular weight
      37 kDa
    • Amino acids
      1 to 334

Specifications

Our Abpromise guarantee covers the use of ab222353 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 300 units/mg, in which one unit will convert 1.0 umole of pyruvate to L-lactate and beta-NAD per minute at pH 7.5 at 37C.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    Purified by conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    Previously labelled as Lactate Dehydrogenase B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 10% Glycerol, 0.32% Tris HCl, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Epididymis secretory protein Li 281
    • HEL S 281
    • L lactate dehydrogenase B chain
    • L-lactate dehydrogenase B chain
    • Lactate Dehydrogenase B
    • Lactate dehydrogenase H chain
    • LDH B
    • LDH H
    • LDH heart subunit
    • LDH-B
    • LDH-H
    • LDHB
    • LDHB_HUMAN
    • LDHBD
    • LDHH
    • Renal carcinoma antigen NY REN 46
    • Renal carcinoma antigen NY-REN-46
    • TRG-5
    • TRG5
    see all
  • Pathway
    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease
    Note=Defects in LDHB result in deficiency of lactate dehydrogenase, a condition with no clear symptomatic consequences. Lactate dehydrogenase deficiency can probably be considered a non-disease.
  • Sequence similarities
    Belongs to the LDH/MDH superfamily. LDH family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • Recombinant human Lactate Dehydrogenase B/LDH-B (3μg) analysed by 15% SDS-PAGE.

References

ab222353 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222353.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up