Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEP AIPEYISCLK QALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTT YCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDD HMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPG HGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKN TPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
    • Molecular weight

      33 kDa
    • Amino acids

      1 to 288

Specifications

Our Abpromise guarantee covers the use of ab151896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151896 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.03% EDTA, 0.88% Sodium chloride

General Info

  • Alternative names

    • Beta lactamase like protein 2
    • Beta-lactamase-like protein 2
    • CGI 83
    • CGI-83
    • LACB2_HUMAN
    • Lactamase beta 2
    • LACTB2
    • MGC112672
    • MGC140671
    • MGC7674
    • OTTHUMP00000226691
    • OTTHUMP00000226692
    see all
  • Sequence similarities

    Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family.
  • Information by UniProt

References

ab151896 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up