Description

  • Product name

    Recombinant Human LAE protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFN FASYVLDYWAQKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVAN VFTQTCGLQQ
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165108 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ACSM1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACSM1
    • ACSM1_HUMAN
    • Acyl-CoA synthetase medium-chain family member 1
    • Acyl-coenzyme A synthetase ACSM1
    • BUCS1
    • Butyrate--CoA ligase 1
    • Butyryl-coenzyme A synthetase 1
    • LAE
    • Lipoate-activating enzyme
    • MACS1
    • Middle-chain acyl-CoA synthetase 1
    • mitochondrial
    see all
  • Function

    Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro). Functions as GTP-dependent lipoate-activating enzyme that generates the substrate for lipoyltransferase.
  • Sequence similarities

    Belongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab165108 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165108 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165108.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up