Bioactive grade

Recombinant human LAG-3 protein (Active) (Biotin) (ab246185)

Description

  • Product name

    Recombinant human LAG-3 protein (Active) (Biotin)
    See all LAG-3 proteins and peptides
  • Biological activity

    Assay 1: Immobilized Madarex LAG-3 Mab, Human IgG1 at 2 μg/mL (100 μL/well) can bind ab246185 with a linear range of 0.4-13 ng/mL.

    Assay 2: Flow Cytometry assay shows that ab246185 can bind to Daudi cell surface. The concentration of LAG-3 used is 0.3 μg/mL.

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPP AAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQL DERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMT ASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLA ESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYA GAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLED VSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVT PVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLG AAVYFTELSSPGAQRSGRAPGALPAGHL
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      23 to 450
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      Mouse IgG2a Fc tag. The single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246185 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    This product was previously labelled as Lymphocyte Activation Gene 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD223
    • CD223 antigen
    • FDC protein
    • LAG-3
    • Lag3
    • LAG3_HUMAN
    • Lymphocyte activating 3
    • Lymphocyte activation gene 3
    • Lymphocyte activation gene 3 protein
    • Protein FDC
    see all
  • Function

    Involved in lymphocyte activation. Binds to HLA class-II antigens.
  • Tissue specificity

    On cell surface of activated NK and T-lymphocytes.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab246185 under reducing conditions.

    The protein has a calculated MW of 75.4 kDa. The protein migrates as 100 kDa under reducing conditions due to glycosylation.

  • Immobilized Madarex LAG-3 Mab, Human IgG1 at 2 μg/mL (100 μL/well) can bind ab246185 with a linear range of 0.4-13 ng/mL.

  • Flow Cytometry assay shows that ab246185 can bind to Daudi cell surface. The concentration of LAG-3 used is 0.3 μg/mL.

References

ab246185 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246185.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up