Recombinant human LAG-3 protein (Fc Chimera Active) (ab220462)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPP AAAPGHPLAPGPHPAA PSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV QLDERGRQRGDFSLWLRPARRADAGEYR AAVHLRDRALSCRLRLRLGQ ASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQ GRVPVRES PHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPT PL TVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNG DFTLRLEDVSQAQA GTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPG SLGKLLCEVTPVSGQERFVWSSLDTP SQRSFSGPWLEAQEAQLLSQPW QCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAG HL
    • Molecular weight

      72 kDa including tags
    • Amino acids

      23 to 450
    • Additional sequence information

      This protein carries a human IgG1 Fc tag at the C-terminus (NP_002277.4).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized ab220462 at 2μg/mL (100 μL/well) can bind Anti-LAG3 MAb, Human IgG1 with a linear range of 0.1-2 ng/mL.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    This product was previously labelled as Lymphocyte Activation Gene 3.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 5% Trehalose, 0.75% Glycine, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD223
    • CD223 antigen
    • FDC protein
    • LAG-3
    • Lag3
    • LAG3_HUMAN
    • Lymphocyte activating 3
    • Lymphocyte activation gene 3
    • Lymphocyte activation gene 3 protein
    • Protein FDC
    see all
  • Function

    Involved in lymphocyte activation. Binds to HLA class-II antigens.
  • Tissue specificity

    On cell surface of activated NK and T-lymphocytes.
  • Sequence similarities

    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized ab220462 at 2 μg/mL (100 μL/well) can bind Madarex LAG-3 MAb with a linear range of 0.4-3 ng/mL

  • The purity of ab220462 was greater than 90% as determined by SEC-HPLC.

  • SDS-PAGE analysis of reduced ab220462 stained overnight with Coomassie Blue.

    The protein migrates as 90-100 kDa under reducing conditions (SDS-PAGE) due to glycosylation.

References

ab220462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up