Description

  • Product name

    Recombinant Human LAIR2 protein
    See all LAIR2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151638 is more than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as an 0.2 µm filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAPVDHHHHHH
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      22 to 152
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • CD306
    • CD306 antigen
    • LAIR 2
    • LAIR-2
    • LAIR2
    • LAIR2_HUMAN
    • Leukocyte associated Ig like receptor 2
    • Leukocyte associated immunoglobulin like receptor 2
    • Leukocyte-associated immunoglobulin-like receptor 2
    • MGC71634
    • OTTHUMP00000068389
    • OTTHUMP00000068390
    see all
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up