Recombinant human LAIR2 protein (ab182705)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human LAIR2 protein
See all LAIR2 proteins and peptides -
Biological activity
Measured by the ability of the immobilized protein to support the adhesion of HT-29 human colon adenocarcinoma cells.
When 10000 cells/well are added to ab182705 coated plates (50 μg/ml with 100 μl/well), approximately >40% cells will adhere after 10 minutes at 37°C. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAP -
Predicted molecular weight
15 kDa including tags -
Amino acids
22 to 152 -
Tags
His tag C-Terminus -
Additional sequence information
AAH69366
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab182705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.40
Constituents: PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- CD306
- CD306 antigen
- LAIR 2
see all -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Human LAIR-2, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
Immobilized Human Collagen I protein at 2 µg/mL (100 µL/well) can bind Human LAIR-2, His Tag with a linear range of 5-78 ng/mL.
-
DTT-reduced SDS-PAGE analysis of ab182705 stained overnight with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab182705 has been referenced in 1 publication.
- Fu Q et al. Human decidua mesenchymal stem cells regulate decidual natural killer cell function via interactions between collagen and leukocyte-associated immunoglobulin-like receptor 1. Mol Med Rep 16:2791-2798 (2017). PubMed: 28677766