Recombinant human LAIR2 protein (ab182705)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant human LAIR2 protein
See all LAIR2 proteins and peptides -
Biological activity
Measured by the ability of the immobilized protein to support the adhesion of HT-29 human colon adenocarcinoma cells.
When 10000 cells/well are added to ab182705 coated plates (50 μg/ml with 100 μl/well), approximately >40% cells will adhere after 10 minutes at 37°C. -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAP -
Predicted molecular weight
15 kDa including tags -
Amino acids
22 to 152 -
Tags
His tag C-Terminus -
Additional sequence information
AAH69366
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab182705 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.40
Constituents: 100% PBS, 5% TrehaloseThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.
General Info
-
Alternative names
- CD306
- CD306 antigen
- LAIR 2
see all -
Sequence similarities
Contains 1 Ig-like C2-type (immunoglobulin-like) domain. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant human LAIR2 protein (ab182705)Human LAIR-2, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%. -
Functional Studies - Recombinant human LAIR2 protein (ab182705)Immobilized Human Collagen I protein at 2 µg/mL (100 µL/well) can bind Human LAIR-2, His Tag with a linear range of 5-78 ng/mL. -
SDS-PAGE - Recombinant human LAIR2 protein (ab182705)DTT-reduced SDS-PAGE analysis of ab182705 stained overnight with Coomassie Blue.
Datasheets and documents
References
ab182705 has not yet been referenced specifically in any publications.
