Description

  • Product name

    Recombinant Human LAIR2 protein (Tagged) (Biotin)
    See all LAIR2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKDS YNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVK ESSGGPDSPDTEPGSSAGTVPGTEASGFDAP
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      22 to 152
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      Full-length mature chain lacking the signal peptide. The single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246202 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • CD306
    • CD306 antigen
    • LAIR 2
    • LAIR-2
    • LAIR2
    • LAIR2_HUMAN
    • Leukocyte associated Ig like receptor 2
    • Leukocyte associated immunoglobulin like receptor 2
    • Leukocyte-associated immunoglobulin-like receptor 2
    • MGC71634
    • OTTHUMP00000068389
    • OTTHUMP00000068390
    see all
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab246202 under reducing conditions.

    The protein has a calculated MW of 17.8 kDa. The protein migrates as 25-28 kDa under reducing conditions due to glycosylation.

References

ab246202 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246202.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up