Overview

  • Product name
    Recombinant Human Laminin 5 alpha 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPC NCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCP HTNSFATGCV
    • Amino acids
      29 to 138
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E170
    • Epiligrin 170 kDa subunit
    • Epiligrin subunit alpha
    • Kalinin subunit alpha
    • LAMA3
    • LAMA3A
    • Laminin 5 alpha3
    • Laminin A3
    • laminin alpha 3
    • laminin alpha3
    • Laminin subunit alpha-3
    • Laminin-5 subunit alpha
    • Laminin-6 subunit alpha
    • Laminin-7 subunit alpha
    • laminin5 alpha 3
    • Laminin5 alpha3
    • LAMNA
    • LOCS
    • Nicein subunit alpha
    see all
  • Relevance
    Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminin 5 is an isoform composed of three distinct subunits, alpha 3, beta 3 and gamma 2, which are bound to each other in a cross-shaped molecule by disulphide bonds. It is a complex glycoprotein thought to be involved in cell adhesion via integrin alpha-3/beta-1 in focal adhesion and integrin alpha-6/beta-4 in hemidesmosomes. It is also involved in signal transduction via tyrosine phosphorylation of pp125-FAK and p80, and differentiation of keratinocytes. The laminin alpha 3 subunit is also thought to be a component of laminin 6 and laminin 7.
  • Cellular localization
    Secreted

Images

  • ab158810 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up