Overview

  • Product name

    Recombinant Human Laminin alpha 4/LAMA4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPET SEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQC LESFTWARSVRKLEIKSFPL
    • Molecular weight

      39 kDa including tags
    • Amino acids

      1 to 120

Specifications

Our Abpromise guarantee covers the use of ab152494 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CMD1JJ
    • DKFZp686D23145
    • LAMA3
    • LAMA3, formerly
    • LAMA4
    • LAMA4 1
    • LAMA4*-1
    • LAMA4_HUMAN
    • Laminin alpha 4
    • Laminin alpha 4 chain
    • Laminin subunit alpha 4 precursor
    • Laminin subunit alpha-4
    • Laminin-14 subunit alpha
    • Laminin-8 subunit alpha
    • Laminin-9 subunit alpha
    see all
  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    In adult, strong expression in heart, lung, ovary small and large intestines, placenta, liver; weak or no expression in skeletal muscle, kidney, pancreas, testis, prostate, brain. High expression in fetal lung and kidney. Expression in fetal and newborn tissues is observed in certain mesenchymal cells in tissues such as smooth muscle and dermis.
  • Involvement in disease

    Cardiomyopathy, dilated 1JJ
  • Sequence similarities

    Contains 4 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
  • Domain

    The alpha-helical domains I and II are thought to interact with other laminin chains to form a coiled coil structure.
    Domain G is globular.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane. Major component.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152494 stained with Coomassie Blue.

References

ab152494 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152494.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up