Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQE GPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRP LGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVR PLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVL CDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPE PMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC
    • Molecular weight

      47 kDa including tags
    • Amino acids

      3401 to 3692
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-SUMO-tag.

Specifications

Our Abpromise guarantee covers the use of ab235807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Laminin alpha 5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • KIAA0533
    • KIAA1907
    • LAMA5
    • LAMA5_HUMAN
    • Laminin alpha 5 chain
    • Laminin subunit alpha 5
    • Laminin subunit alpha-5
    • Laminin, alpha 5
    • Laminin-10 subunit alpha
    • Laminin-11 subunit alpha
    • Laminin-15 subunit alpha
    • RP11-157P1.6
    see all
  • Function

    Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
  • Tissue specificity

    Expressed in heart, lung, kidney, skeletal muscle, pancreas, retina and placenta. Little or no expression in brain and liver.
  • Sequence similarities

    Contains 22 laminin EGF-like domains.
    Contains 5 laminin G-like domains.
    Contains 1 laminin IV type A domain.
    Contains 1 laminin N-terminal domain.
  • Domain

    Domain G is globular and is part of the major cell-binding site located in the long arm of the laminin heterotrimer.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane. Major component.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel analysis of ab235807.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235807 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Laminin alpha 5/LAMA5.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab235807 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) Laminin alpha 5/LAMA5.

References

ab235807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up