Overview

  • Product name

    Recombinant Human LAMP2B protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSI CGDDQNGPKIAVQFG PGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAI RIPLNDLFRCNSLST LEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSP TTTPTPKEKPEAGTY SVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLR LNSSTIKYLDFVFAV KNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVS VSGAFQINTFDLRVQ PFNVTQGKYSTAQECSLDDDTI
    • Molecular weight

      39 kDa including tags
    • Amino acids

      29 to 375
    • Tags

      His tag C-Terminus
    • Additional sequence information

      A polyhistidine tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab151915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

General Info

  • Alternative names

    • CD_antigen=CD107b
    • CD107 antigen like family member B
    • CD107 antigen-like family member B
    • CD107b
    • LAMP 2
    • Lamp 2b
    • LAMP-2
    • LAMP2
    • LAMP2_HUMAN
    • LAMPB
    • LGP110
    • Lysosomal associated membrane protein 2
    • Lysosome associated membrane glycoprotein 2
    • Lysosome-associated membrane glycoprotein 2
    • Lysosome-associated membrane protein 2
    • MAC3
    see all
  • Function

    Implicated in tumor cell metastasis. May function in protection of the lysosomal membrane from autodigestion, maintenance of the acidic environment of the lysosome, adhesion when expressed on the cell surface (plasma membrane), and inter- and intracellular signal transduction. Protects cells from the toxic effects of methylating mutagens.
  • Tissue specificity

    Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle. Isoform LAMP-2B is highly expressed in skeletal muscle, less in brain, placenta, lung, kidney and pancreas, very low in liver.
  • Involvement in disease

    Danon disease
  • Sequence similarities

    Belongs to the LAMP family.
  • Post-translational
    modifications

    O- and N-glycosylated; some of the 16 N-linked glycans are polylactosaminoglycans.
  • Cellular localization

    Cell membrane. Endosome membrane. Lysosome membrane. This protein shuttles between lysosomes, endosomes, and the plasma membrane.
  • Information by UniProt

References

ab151915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up