Overview

  • Product name
    Recombinant Human LANCL2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCV RPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDC SAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCG DAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGR AGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPL LYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMEC SDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC LDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD
    • Amino acids
      1 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 69B
    • GPR69B
    • LanC (bacterial lantibiotic synthetase component C) like 2
    • LanC-like protein 2
    • LANC2_HUMAN
    • LANCL2
    • TASP
    • Testis specific adriamycin sensitivity protein
    • Testis-specific adriamycin sensitivity protein
    see all
  • Function
    Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
  • Tissue specificity
    Expressed in brain and testis.
  • Sequence similarities
    Belongs to the LanC-like protein family.
  • Post-translational
    modifications
    Myristoylated. Essential for membrane association.
  • Cellular localization
    Nucleus. Cytoplasm. Cell membrane. Localizes to the juxta-nuclear vesicles. Associates with the cortical actin cytoskeleton. Cholesterol depletion by methyl-beta-cyclodextrin causes partial dissociation from the cell membrane in vitro and an enhanced cell detachment from the matrix in vivo. Membrane-association is important for the increased cellular sensitivity to an anticancer drug.
  • Information by UniProt

Images

  • ab163277 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up