Overview

  • Product name

    Recombinant Human LAP3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMFLLPLPAAGRVVVRRLAVRRFGSRSLSTA DMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRETLNISGPPLKA GKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCR QIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGS GDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKT EVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIG LAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHT FNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVW RMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL DIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA
    • Molecular weight

      58 kDa including tags
    • Amino acids

      1 to 519
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_056991.

Specifications

Our Abpromise guarantee covers the use of ab202613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab202613 was purified using conventional chromatography.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.32% Tris HCl, 0.03% EDTA, 50% Glycerol, 0.08% DTT

General Info

  • Alternative names

    • AMPL_HUMAN
    • Cytosol aminopeptidase
    • epididymis secretory protein Li 106
    • HEL-S-106
    • LAP
    • LAP 3
    • LAP-3
    • Lap3
    • LAPEP
    • Leucine aminopeptidase 3
    • Leucyl aminopeptidase
    • PEPS
    • Peptidase S
    • Proline aminopeptidase
    • Prolyl aminopeptidase
    see all
  • Function

    Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.
  • Sequence similarities

    Belongs to the peptidase M17 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202613 (3μg).

References

ab202613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up