Overview

  • Product name
    Recombinant Human LAPTM4A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVE VTHPNSMPAVNIQYEVIGNYYSSERMADNACVLFAVSVLMFIISSMLVYG AISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYK DDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAV YPAFEAPPQYVLPTYEMAVKMPEKEPPPPYLPA
    • Amino acids
      1 to 233
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Golgi 4 transmembrane spanning transporter MTP
    • Golgi 4-transmembrane-spanning transporter MTP
    • HUMORF13
    • KIAA0108
    • LAP4A_HUMAN
    • LAPTM4
    • LAPTM4A
    • Lysosomal associated protein transmembrane 4 alpha
    • Lysosomal associated transmembrane protein 4A
    • Lysosomal protein transmembrane 4 alpha
    • Lysosomal-associated transmembrane protein 4A
    • MBNT
    • Membrane nucleoside transporter
    • MTRP
    see all
  • Function
    May function in the transport of nucleosides and/or nucleoside derivatives between the cytosol and the lumen of an intracellular membrane-bound compartment.
  • Sequence similarities
    Belongs to the LAPTM4/LAPTM5 transporter family.
  • Domain
    The C-terminal domain is necessary for retention within intracelllular membranes.
  • Cellular localization
    Endomembrane system. May reside in an intracellular membrane-bound compartment.
  • Information by UniProt

Images

  • ab160633 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up