Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKA SCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSL QIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSI LTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITV LIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSK TPEGGPAPPPYSEV
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 262

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152818 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • LAPM5_HUMAN
    • LAPTM5
    • Lysosomal-associated multitransmembrane protein 5
    • Lysosomal-associated transmembrane protein 5
    • Retinoic acid-inducible E3 protein
    see all
  • Function

    May have a special functional role during embryogenesis and in adult hematopoietic cells.
  • Tissue specificity

    Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. Highly expressed in peripheral blood leukocytes, thymus, spleen and lung, followed by placenta, liver and kidney.
  • Sequence similarities

    Belongs to the LAPTM4/LAPTM5 transporter family.
  • Cellular localization

    Lysosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152818 stained with Coomassie Blue.

References

ab152818 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152818.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up