Overview

  • Product name

    Recombinant Human LARP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNL YEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCS DCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRP LDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQ FPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWG TVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARRLQSLARP GARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKM QAQMQRSQAQGEQSDAL
    • Molecular weight

      66 kDa including tags
    • Amino acids

      1 to 367

Specifications

Our Abpromise guarantee covers the use of ab132552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.

     This product was previously labelled as SEPT1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DIFF6
    • Differentiation 6 (deoxyguanosine triphosphate triphosphohydrolase)
    • LARP
    • MGC20394
    • Peanut like protein 3
    • Peanut-like protein 3
    • PNUTL3
    • SEP1
    • SEPT1
    • SEPT1_HUMAN
    • Septin 1
    • Septin-1
    • Serologically defined breast cancer antigen NY BR 24
    • Serologically defined breast cancer antigen NY-BR-24
    see all
  • Function

    Filament-forming cytoskeletal GTPase (By similarity). May play a role in cytokinesis.
  • Tissue specificity

    Expressed at high levels in lymphoid and haematopoietic tissues.
  • Sequence similarities

    Belongs to the septin family.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Remains at the centrosomes and the nearby microtubules throughout mitosis. Localizes to the midbody during cytokinesis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132552 stained with Coomassie Blue.

References

ab132552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up