Overview

  • Product name
    Recombinant Human LAS1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVAWLSRAE WDQVTVYLFCDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLL DVTGGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKCLAQEVNIPDW IVDLRHELTHKKMPHINDCRRGCYFVLDWLQKTYWCRQLENSLRETWELE EFREGIEEEDQEEDKNIVVDDITEQKPEPQDDGKSTESDVKADGDSKGSE EVDSHCKKALSHKELYERARELLVSYEEEQFTVLEKFRYLPKAIKAWNNP SPRVECVLAELKGVTCENREAVLDAFLDDGFLVPTFEQLAALQIEYEDGQ TEVQRGEGTDPKSHKNVDLNDVLVPKPFSQFWQPLLRGLHSQNFTQALLE RMLSELPALGISGIRPTYILRWTVELIVANTKTGRNARRFSAGQWEARRG WRLFNCSASLDWPRMVESCLGSPCWASPQLLRIIFKAMGQGLPDEEQEKL LRICSIYTQSGENSLVQEGSEASPIGKSPYTLDSLYWSVKPASSSFGSEA KAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEEDEDDEDD EEEDRMEVGPFSTGQESPTAENARLLAQKRGALQGSAWQVSSEDVRWDTF PLGRMPGQTEDPAELMLENYDTMYLLDQPVLEQRLEPSTCKTDTLGLSCG VGSGNCSNSSSSNFEGLLWSQGQLHGLKTGLQLF
    • Amino acids
      1 to 734
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ475B7.2
    • FLJ12525
    • FLJ30133
    • FLJ45274
    • Las1 like
    • LAS1 like (S. cerevisiae)
    • LAS1L
    • LAS1L_HUMAN
    • Protein LAS1 homolog
    • Ribosomal biogenesis protein LAS1L
    • RP3 475B7.2
    see all
  • Function
    Involved in the biogenesis of the 60S ribosomal subunit. Required for maturation of the 28S rRNA. Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes.
  • Sequence similarities
    Belongs to the LAS1 family.
  • Cellular localization
    Nucleus > nucleolus. Nucleus > nucleoplasm. Cytoplasm. Mainly found in the nucleoplasm, with low levels detected in the cytoplasmic and chromatin fractions (By similarity). Localizes mainly to the granular component, the region implicated in the later steps of rRNA processing and subunit assembly and export.
  • Information by UniProt

Images

  • ab164379 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164379 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up