Recombinant Human LAT3 protein (ab160057)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human LAT3 protein
See all LAT3 proteins and peptides -
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRL SQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRK
-
Amino acids212 to 297
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab160057 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- L type amino acid transporter 3
- L-type amino acid transporter 3
- Large neutral amino acids transporter small subunit 3
see all -
FunctionSodium-independent, high affinity transport of large neutral amino acids. Has narrower substrate selectivity compared to SLC7A5 and SLC7A8 and mainly transports branched-chain amino acids and phenylalanine. Plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer.
-
Tissue specificityIn adults, found in all tissues examined with highest expression in pancreas. In fetus, highest expression in liver and lower levels in kidney, and lung. High levels found in prostate cancer cells.
-
Sequence similaritiesBelongs to the SLC43A transporter (TC 2.A.1.44) family.
-
Cellular localizationMembrane.
- Information by UniProt
Images
Datasheets and documents
References
ab160057 has not yet been referenced specifically in any publications.