Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGR YEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKL QGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLG WLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNK MVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFV PRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGAN VQYMRV
    • Amino acids

      26 to 481
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.03% EDTA, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS.

General Info

  • Alternative names

    • BPI fold containing family D, member 2
    • Bpifd2
    • LBP
    • LBP_HUMAN
    • LBP1
    • Lipopolysaccharide binding protein
    • Lipopolysaccharide-binding protein
    • LPS binding protein
    • Ly88
    • MGC22233
    • OTTHUMP00000030965
    • RP23-407H16.4
    see all
  • Function

    Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor.
  • Sequence similarities

    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up