Description

  • Product name

    Recombinant Human LBP protein (His tag)
    See all LBP proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPHVGRGR YEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKL QGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLG WLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSF ADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNK MVYFAISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFV PRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSK EPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLE ALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGAN VQYMRV
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      26 to 481
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 26 to 481. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab201433 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 97% PBS, 3% Trehalose

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is about 3-5%. Lyophilized from 0.22 µm filtered solution

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • BPI fold containing family D, member 2
    • Bpifd2
    • LBP
    • LBP_HUMAN
    • LBP1
    • Lipopolysaccharide binding protein
    • Lipopolysaccharide-binding protein
    • LPS binding protein
    • Ly88
    • MGC22233
    • OTTHUMP00000030965
    • RP23-407H16.4
    see all
  • Function

    Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor.
  • Sequence similarities

    Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • The purity of 201433 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 62 kDa in SDS-PAGE due to glycosylation.

References

ab201433 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201433.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up