Description

  • Product name

    Recombinant Human LCN1 protein
    See all LCN1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMHHLLASDEEIQDVSGTWYLKAMTVD REFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPG KYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLE ALEDFEKAAGARGLSTESILIPRQSETCSPGSD
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      19 to 176
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab187451 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.02% DTT, 10% Glycerol, 89% PBS

General Info

  • Alternative names

    • LCN1
    • LCN1_HUMAN
    • Lipocalin 1 (protein migrating faster than albumin, tear prealbumin)
    • Lipocalin 1 like 2
    • Lipocalin-1
    • PMFA
    • Tear lipocalin
    • Tear prealbumin
    • Tlc
    • TP
    • VEG protein
    • VEGP
    • Von Ebner gland protein
    see all
  • Function

    Could play a role in taste reception. Could be necessary for the concentration and delivery of sapid molecules in the gustatory system. Can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. Exhibits an extremely wide ligand pocket.
  • Tissue specificity

    Mainly expressed in lachrymal and salivary glands. Also expressed in the prostate.
  • Sequence similarities

    Belongs to the calycin superfamily. Lipocalin family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab187451 (3 µg) at approximately 20.1 kDa.

References

ab187451 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187451.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up