Overview

  • Product name

    Recombinant Human LDB3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSYSVTLTGPGPWGFRLQGGKDFNMPLTISRITPGSKAAQSQLSQGDL VVAIDGVNTDTMTHLEAQNKIKSASYNLSLTLQKSKRPIPISTTAPPVQT PLPVIPHQKVVVNSPANADYQERFNPSALKDSALSTHKPIEVKGLGGKAT IIHAQYNTPISMYSQDAIMDAIAGQAQAQGSDFSGSLPIKDLAVDSASPV YQAVIKSQNKPEDEADEWARRSSNLQSRSFRILAQMTGTEFMQDPDEEAL RRSRERFETERNSPRFAKLRNWHHGLSAQILNVKS
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 283

Specifications

Our Abpromise guarantee covers the use of ab132472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CMD1C
    • CYPHER
    • HGNC:15710
    • KIAA01613
    • KIAA0613
    • Ldb3
    • LDB3_HUMAN
    • LDB3Z1
    • LDB3Z4
    • LIM domain binding 3
    • LIM domain binding protein 3
    • LIM domain-binding protein 3
    • LVNC3
    • ORACLE
    • PDLIM6
    • PDZ and LIM domain 6
    • Protein cypher
    • Z band alternatively spliced PDZ motif
    • Z band alternatively spliced PDZ motif protein
    • Z-band alternatively spliced PDZ-motif protein
    • ZASP
    see all
  • Function

    May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.
  • Tissue specificity

    Expressed primarily in skeletal muscle and to a lesser extent in heart. Also detected in brain and placenta.
  • Involvement in disease

    Defects in LDB3 are the cause of cardiomyopathy dilated type 1C (CMD1C) [MIM:601493]. Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death.
    Defects in LDB3 are the cause of left ventricular non-compaction type 3 (LVNC3) [MIM:601493]. Left ventricular non-compaction is characterized by numerous prominent trabeculations and deep intertrabecular recesses in hypertrophied and hypokinetic segments of the left ventricle.
    Defects in LDB3 are the cause of myopathy myofibrillar ZASP-related (MFM-ZASP) [MIM:609452]. A neuromuscular disorder characterized by distal and proximal muscle weakness with signs of cardiomyopathy and neuropathy.
  • Sequence similarities

    Contains 3 LIM zinc-binding domains.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Cytoplasm > perinuclear region. Cell projection > pseudopodium. Cytoplasm > cytoskeleton. Cytoplasm > myofibril > sarcomere > Z line. Localized to the cytoplasm around nuclei and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2 at the Z-lines.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132472 on a 12.5% gel stained with Coomassie Blue.

References

ab132472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up