Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSI IPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIG
    • Amino acids
      71 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Lactate Dehydrogenase C. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 32
    • CT32
    • EC 1.1.1.27
    • L lactate dehydrogenase C chain
    • L-lactate dehydrogenase C chain
    • Lactate Dehydrogenase C
    • Lactate dehydrogenase c variant 1
    • Lactate dehydrogenase c variant 3
    • Lactate dehydrogenase c variant 4
    • Lactate dehydrogenase C4
    • LDH C
    • LDH testis subunit
    • LDH X
    • LDH-C
    • LDH-X
    • LDH3
    • ldhc
    • LDHC_HUMAN
    • LDHX
    • MGC111073
    see all
  • Function
    Possible role in sperm motility.
  • Pathway
    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Sequence similarities
    Belongs to the LDH/MDH superfamily. LDH family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158815 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up