Description

  • Product name

    Recombinant Human LDHA protein
    See all LDHA proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVI EDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGE SRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFP KNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGM NVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGL SVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLV KVTLTSEEEARLKKSADTL
    • Predicted molecular weight

      35 kDa
    • Amino acids

      5 to 323

Specifications

Our Abpromise guarantee covers the use of ab235557 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Cell proliferation-inducing gene 19 protein
    • GSD11
    • L lactate dehydrogenase A chain
    • L-lactate dehydrogenase A chain
    • l7R2
    • Lactate dehydrogenase 1, A chain
    • Lactate dehydrogenase A
    • Lactate dehydrogenase A4
    • Lactate dehydrogenase M
    • LDH A
    • LDH M
    • LDH muscle subunit
    • LDH muscle subunit; M LDH
    • LDH-A
    • LDH-M
    • LDH1
    • ldha
    • LDHA_HUMAN
    • LDHM
    • OTTMUSP00000017774
    • PIG19
    • Proliferation-inducing gene 19
    • Renal carcinoma antigen NY-REN-59
    see all
  • Pathway

    Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1.
  • Involvement in disease

    Defects in LDHA are the cause of glycogen storage disease type 11 (GSD11) [MIM:612933]. A metabolic disorder that results in exertional myoglobinuria, pain, cramps and easy fatigue.
  • Sequence similarities

    Belongs to the LDH/MDH superfamily. LDH family.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235557.

References

ab235557 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235557.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up