Description

  • Product name

    Recombinant human LDL Receptor protein
    See all LDL Receptor proteins and peptides
  • Biological activity

    Assay Conditions: 50 µL reaction mix (50 mM HEPES pH 7.4, 100 mM NaCl, 200 µM CaCl2, 0.05% Tween-20, 0.1% BSA, and up to 1500 ng PCSK9) is added to the wells coated with ab198760. Incubate for 2hr. Add antibody against polyhistidine and then incubate 1 hr. Add secondary HRP labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Purity

    >= 87 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSG DFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKC ISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDP DCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPD CKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCV NVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDN NGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNL EGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTS LIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISR DIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRA IVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLL SGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWT DIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTT LSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVAT QETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQA LGDVAGRGNEKKPSSVRDYKDDDDK
    • Predicted molecular weight

      87 kDa including tags
    • Amino acids

      22 to 788
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      NM_000527.

Specifications

Our Abpromise guarantee covers the use of ab198760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FH
    • FHC
    • LDL R
    • LDL receptor
    • LDLCQ2
    • Ldlr
    • LDLR_HUMAN
    • Low Density Lipoprotein Receptor
    • Low density lipoprotein receptor class A domain containing protein 3
    • Low density lipoprotein receptor familial hypercholesterolemia
    • Low-density lipoprotein receptor
    see all
  • Function

    Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.
  • Involvement in disease

    Defects in LDLR are the cause of familial hypercholesterolemia (FH) [MIM:143890]; a common autosomal semi-dominant disease that affects about 1 in 500 individuals. The receptor defect impairs the catabolism of LDL, and the resultant elevation in plasma LDL-cholesterol promotes deposition of cholesterol in the skin (xanthelasma), tendons (xanthomas), and coronary arteries (atherosclerosis).
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 3 EGF-like domains.
    Contains 7 LDL-receptor class A domains.
    Contains 6 LDL-receptor class B repeats.
  • Post-translational
    modifications

    N- and O-glycosylated.
    Ubiquitinated by MYLIP leading to degradation.
  • Cellular localization

    Cell membrane. Endomembrane system. Membrane > clathrin-coated pit. Found distributed from the plasma membrane to intracellular compartments.
  • Information by UniProt

Images

  • Activity assay using ab198760 showing PCSK9-LDL Receptor interation.

  • 4-20% SDS-PAGE analysis of 3 µg ab198760 with Coomassie staining.

    LDL Receptor is heavily glycosylated, resulting in higher molecular weight. The two bands shown correspond to differing states of glycosylation.

References

ab198760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up