Description

  • Product name

    Recombinant human LDL Receptor protein (Active)
    See all LDL Receptor proteins and peptides
  • Biological activity

    Immobilized Human PCSK9, His Tag at 5μg/mL (100 μL/well) can bind ab220570 with a linear range of 8-320 ng/mL.

  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µl
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGG RVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFV CDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGS DEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSD EENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCE GPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSH VCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKC QCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLR NVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPD GLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPV HGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYW VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA IFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGC QYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTV RLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAG R
    • Predicted molecular weight

      111 kDa
    • Amino acids

      22 to 788
    • Additional sequence information

      extracellular domain with Fc fragment of human IgG1 at the C-terminus. Accession # NP_000518.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220570 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, 0.44% L-Arginine, 0.87% Sodium chloride

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • FH
    • FHC
    • LDL R
    • LDL receptor
    • LDLCQ2
    • Ldlr
    • LDLR_HUMAN
    • Low Density Lipoprotein Receptor
    • Low density lipoprotein receptor class A domain containing protein 3
    • Low density lipoprotein receptor familial hypercholesterolemia
    • Low-density lipoprotein receptor
    see all
  • Function

    Binds LDL, the major cholesterol-carrying lipoprotein of plasma, and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. In case of HIV-1 infection, functions as a receptor for extracellular Tat in neurons, mediating its internalization in uninfected cells.
  • Involvement in disease

    Defects in LDLR are the cause of familial hypercholesterolemia (FH) [MIM:143890]; a common autosomal semi-dominant disease that affects about 1 in 500 individuals. The receptor defect impairs the catabolism of LDL, and the resultant elevation in plasma LDL-cholesterol promotes deposition of cholesterol in the skin (xanthelasma), tendons (xanthomas), and coronary arteries (atherosclerosis).
  • Sequence similarities

    Belongs to the LDLR family.
    Contains 3 EGF-like domains.
    Contains 7 LDL-receptor class A domains.
    Contains 6 LDL-receptor class B repeats.
  • Post-translational
    modifications

    N- and O-glycosylated.
    Ubiquitinated by MYLIP leading to degradation.
  • Cellular localization

    Cell membrane. Endomembrane system. Membrane > clathrin-coated pit. Found distributed from the plasma membrane to intracellular compartments.
  • Information by UniProt

Images

  • Immobilized Human PCSK9 (D374Y) (His Tag) at 5µg/mL (100 µL/well) can bind Human LDL R (Fc Tag) with a linear range of 8-320 ng/mL (QC tested).
  • ab220570 on SDS-PAGE under reducing (lane 1) and no-reducing (lane 2) conditions. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.  As a result of glycosylation, the reduced protein migrates at 155-175 kDa and the non-reduced protein migrates at 310-350 kDa.

  • Example of ab220570 bioactivity.

References

ab220570 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220570.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up