Description

  • Product name

    Recombinant Human LDLC protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDD DKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
    • Amino acids

      639 to 738
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as COG2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Brefeldin A sensitive peripheral Golgi protein
    • CDG2Q
    • COG 2
    • COG complex subunit 2
    • COG2
    • COG2_HUMAN
    • Component of oligomeric Golgi complex 2
    • Conserved oligomeric Golgi complex component 2
    • Conserved oligomeric Golgi complex subunit 2
    • LDLC
    • Low density lipoprotein receptor defect C complementing protein
    • Low density lipoprotein receptor defect C-complementing protein
    • Transcript ch4822
    see all
  • Function

    Required for normal Golgi morphology and function.
  • Sequence similarities

    Belongs to the COG2 family.
  • Cellular localization

    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab161426 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161426 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161426.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up